PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A00281.3.p
Common NameEUGRSUZ_A00281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 261aa    MW: 29393.7 Da    PI: 9.4365
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A00281.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1865.7e-2795183290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       fY+eYA++vGF +r+ + ++s+r+g+i  r++ C+keg+  + + k    r++ra+tr gCka+++vk +++gkw++tk+++eHnH+l+
  Eucgr.A00281.3.p  95 FYDEYARRVGFVMRVMSCRRSERDGKILARRLGCNKEGYCVSIRGKFGPVRKPRASTREGCKAMIHVKVDRSGKWVITKFVKEHNHPLV 183
                       9**************************************99999998****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.6E-2595183IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MESGPTMTGR AAGYGGVPHS LSTFSRLAFC SSRHRSPTKR SIKSQPIRIE PMDLEDEAGA  60
TENSGGVELV DCEGDPIVEP CEGMEFDSED AAKIFYDEYA RRVGFVMRVM SCRRSERDGK  120
ILARRLGCNK EGYCVSIRGK FGPVRKPRAS TREGCKAMIH VKVDRSGKWV ITKFVKEHNH  180
PLVISPREAR QTMDEKDKKI QELTAELRNK KRLCAAYQEQ LTAFVKIVEE HNDQLSKKVQ  240
SVVNNIRKYE PVDPGLMRRS *
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A00281.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064027.11e-169PREDICTED: uncharacterized protein LOC104450980
TrEMBLA0A059DBX80.0A0A059DBX8_EUCGR; Uncharacterized protein
STRINGGLYMA06G48170.31e-112(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-109FAR1 family protein